SCOPe 2.07: Domain d1e6ma1: 1e6m A:3-129

Lineage for d1e6ma1 (1e6m A:3-129)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1e6ma1: 1e6m A:3-129 [31039]
   Other proteins in same PDB: d1e6ma2
   mutant

Details for d1e6ma1

PDB Entry: 1e6m, 1.7 Å

PDB Description: two-component signal transduction system d57a mutant of chey

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1e6ma1:

Sequence; same for both SEQRES and ATOM records:

>d1e6ma1 c.23.1.1 (A:3-129) CheY protein {Escherichia coli [TaxId: 562]}
dkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisawnmpn
mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
ifeklgm

Timeline for d1e6ma1:

• d1e6ma1 first appeared (with stable ids) in SCOP 1.55, called d1e6ma_
  
• d1e6ma1 appears in SCOPe 2.06
  
• d1e6ma1 appears in the current release, SCOPe 2.08