SCOPe 2.06: Domain d5d6xb1: 5d6x B:897-955

Lineage for d5d6xb1 (5d6x B:897-955)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein automated matches [190752] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187947] (6 PDB entries)

8. Domain d5d6xb1: 5d6x B:897-955 [310388]
   automated match to d2gfaa2
   complexed with so4

Details for d5d6xb1

PDB Entry: 5d6x, 2.15 Å

PDB Description: crystal structure of double tudor domain of human lysine demethylase kdm4a

PDB Compounds: (B:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5d6xb1:

Sequence; same for both SEQRES and ATOM records:

>d5d6xb1 b.34.9.1 (B:897-955) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

Timeline for d5d6xb1:

• d5d6xb1 is new in SCOPe 2.06-stable
  
• d5d6xb1 appears in SCOPe 2.07
  
• d5d6xb1 appears in the current release, SCOPe 2.08