| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein automated matches [190752] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187947] (8 PDB entries) |
| Domain d5d6xa2: 5d6x A:956-1011 [310387] automated match to d2qqra2 complexed with so4 |
PDB Entry: 5d6x (more details), 2.15 Å
SCOPe Domain Sequences for d5d6xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d6xa2 b.34.9.1 (A:956-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
Timeline for d5d6xa2: