Lineage for d5d6xa1 (5d6x A:897-955)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055135Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2055136Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2055220Protein automated matches [190752] (1 species)
    not a true protein
  7. 2055221Species Human (Homo sapiens) [TaxId:9606] [187947] (6 PDB entries)
  8. 2055232Domain d5d6xa1: 5d6x A:897-955 [310386]
    automated match to d2gfaa2
    complexed with so4

Details for d5d6xa1

PDB Entry: 5d6x (more details), 2.15 Å

PDB Description: crystal structure of double tudor domain of human lysine demethylase kdm4a
PDB Compounds: (A:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5d6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d6xa1 b.34.9.1 (A:897-955) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

SCOPe Domain Coordinates for d5d6xa1:

Click to download the PDB-style file with coordinates for d5d6xa1.
(The format of our PDB-style files is described here.)

Timeline for d5d6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d6xa2