Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein automated matches [190752] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187947] (6 PDB entries) |
Domain d5d6xa1: 5d6x A:897-955 [310386] automated match to d2gfaa2 complexed with so4 |
PDB Entry: 5d6x (more details), 2.15 Å
SCOPe Domain Sequences for d5d6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d6xa1 b.34.9.1 (A:897-955) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg
Timeline for d5d6xa1: