Lineage for d1dmga_ (1dmg A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21765Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
  4. 21766Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 21767Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 21768Protein Ribosomal protein L4 [52168] (2 species)
  7. 21771Species Thermotoga maritima [TaxId:243274] [52169] (1 PDB entry)
  8. 21772Domain d1dmga_: 1dmg A: [31036]

Details for d1dmga_

PDB Entry: 1dmg (more details), 1.7 Å

PDB Description: crystal structure of ribosomal protein l4

SCOP Domain Sequences for d1dmga_:

Sequence, based on SEQRES records: (download)

>d1dmga_ c.22.1.1 (A:) Ribosomal protein L4 {Thermotoga maritima}
aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsnrragtastktrgevsggg
rkpwpqkhtgrarhgsirspiwrhggvvhgpkprdwskklnkkmkklalrsalsvkyren
kllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnlpdvkvii
adnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg

Sequence, based on observed residues (ATOM records): (download)

>d1dmga_ c.22.1.1 (A:) Ribosomal protein L4 {Thermotoga maritima}
aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsdwskklnkkmkklalrsal
svkyrenkllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnl
pdvkviiadnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg

SCOP Domain Coordinates for d1dmga_:

Click to download the PDB-style file with coordinates for d1dmga_.
(The format of our PDB-style files is described here.)

Timeline for d1dmga_: