Lineage for d1dmga_ (1dmg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101502Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 2101503Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 2101504Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 2101505Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 2101586Species Thermotoga maritima [TaxId:2336] [52169] (1 PDB entry)
  8. 2101587Domain d1dmga_: 1dmg A: [31036]
    complexed with cit

Details for d1dmga_

PDB Entry: 1dmg (more details), 1.7 Å

PDB Description: crystal structure of ribosomal protein l4
PDB Compounds: (A:) ribosomal protein l4

SCOPe Domain Sequences for d1dmga_:

Sequence, based on SEQRES records: (download)

>d1dmga_ c.22.1.1 (A:) Ribosomal protein L4 {Thermotoga maritima [TaxId: 2336]}
aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsnrragtastktrgevsggg
rkpwpqkhtgrarhgsirspiwrhggvvhgpkprdwskklnkkmkklalrsalsvkyren
kllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnlpdvkvii
adnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg

Sequence, based on observed residues (ATOM records): (download)

>d1dmga_ c.22.1.1 (A:) Ribosomal protein L4 {Thermotoga maritima [TaxId: 2336]}
aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsdwskklnkkmkklalrsal
svkyrenkllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnl
pdvkviiadnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg

SCOPe Domain Coordinates for d1dmga_:

Click to download the PDB-style file with coordinates for d1dmga_.
(The format of our PDB-style files is described here.)

Timeline for d1dmga_: