SCOPe 2.08: Domain d5cqha1: 5cqh A:189-378

Lineage for d5cqha1 (5cqh A:189-378)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein automated matches [310855] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311219] (20 PDB entries)

8. Domain d5cqha1: 5cqh A:189-378 [310350]
   Other proteins in same PDB: d5cqha2
   automated match to d4xxoa_
   complexed with cl, dc, edo, zn

Details for d5cqha1

PDB Entry: 5cqh, 1.73 Å

PDB Description: crystal structure of the cancer genomic dna mutator apobec3b

PDB Compounds: (A:) DNA dC-dU-editing enzyme APOBEC-3B

SCOPe Domain Sequences for d5cqha1:

Sequence; same for both SEQRES and ATOM records:

>d5cqha1 c.97.1.6 (A:189-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrylmdpdtftsnfnndplvlrrrqtylcyeverldngtsvkmdqhmgflcnesgrhael
rfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrikaariydyd
plykealqmlrdagaqvsimtydefeycwdtfvyrqgcpfqpwdgleehsqalsgrlrai
lq

Timeline for d5cqha1:

• d5cqha1 first appeared in SCOPe 2.06
  
• d5cqha1 appears in SCOPe 2.07