Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries) Uniprot P29198 |
Domain d1ffkg_: 1ffk G: [31035] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ complexed with cd, k, mg |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkg_ c.21.1.1 (G:) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlganktw
Timeline for d1ffkg_:
View in 3D Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |