Lineage for d5ceyc2 (5cey C:109-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353218Domain d5ceyc2: 5cey C:109-210 [310342]
    Other proteins in same PDB: d5ceya1, d5ceyc1
    automated match to d1jvka2
    complexed with gol, p6g, pe7

Details for d5ceyc2

PDB Entry: 5cey (more details), 2.39 Å

PDB Description: crystal structure of fab 9h+3l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
PDB Compounds: (C:) Antibody 9H+3L Fab light chain

SCOPe Domain Sequences for d5ceyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ceyc2 b.1.1.2 (C:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d5ceyc2:

Click to download the PDB-style file with coordinates for d5ceyc2.
(The format of our PDB-style files is described here.)

Timeline for d5ceyc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ceyc1