SCOPe 2.08: Domain d5cexc2: 5cex C:109-211

Lineage for d5cexc2 (5cex C:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5cexc2: 5cex C:109-211 [310338]
   Other proteins in same PDB: d5cexa1, d5cexb1, d5cexb2, d5cexc1, d5cexd1, d5cexd2
   automated match to d1lila2
   complexed with gol, p6g, pg4, pge

Details for d5cexc2

PDB Entry: 5cex, 2.11 Å

PDB Description: crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies

PDB Compounds: (C:) Antibody 9H+3L Fab light chain

SCOPe Domain Sequences for d5cexc2:

Sequence; same for both SEQRES and ATOM records:

>d5cexc2 b.1.1.2 (C:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapte

Timeline for d5cexc2:

• d5cexc2 first appeared in SCOPe 2.06
  
• d5cexc2 appears in SCOPe 2.07