Lineage for d5cexa1 (5cex A:6-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033183Domain d5cexa1: 5cex A:6-108 [310335]
    Other proteins in same PDB: d5cexa2, d5cexc2
    automated match to d1lila1
    complexed with gol, p6g, pg4, pge

Details for d5cexa1

PDB Entry: 5cex (more details), 2.11 Å

PDB Description: crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
PDB Compounds: (A:) Antibody 9H+3L Fab light chain

SCOPe Domain Sequences for d5cexa1:

Sequence, based on SEQRES records: (download)

>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs
pdsnfgttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg

Sequence, based on observed residues (ATOM records): (download)

>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs
pdttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg

SCOPe Domain Coordinates for d5cexa1:

Click to download the PDB-style file with coordinates for d5cexa1.
(The format of our PDB-style files is described here.)

Timeline for d5cexa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cexa2