Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5cexa1: 5cex A:6-108 [310335] Other proteins in same PDB: d5cexa2, d5cexc2 automated match to d1lila1 complexed with gol, p6g, pg4, pge |
PDB Entry: 5cex (more details), 2.11 Å
SCOPe Domain Sequences for d5cexa1:
Sequence, based on SEQRES records: (download)
>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs pdsnfgttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg
>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs pdttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg
Timeline for d5cexa1: