SCOPe 2.08: Domain d5cexa1: 5cex A:6-108

Lineage for d5cexa1 (5cex A:6-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5cexa1: 5cex A:6-108 [310335]
   Other proteins in same PDB: d5cexa2, d5cexb2, d5cexc2, d5cexd2
   automated match to d1lila1
   complexed with gol, p6g, pg4, pge

Details for d5cexa1

PDB Entry: 5cex, 2.11 Å

PDB Description: crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies

PDB Compounds: (A:) Antibody 9H+3L Fab light chain

SCOPe Domain Sequences for d5cexa1:

Sequence, based on SEQRES records:

>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs
pdsnfgttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg

Sequence, based on observed residues (ATOM records):

>d5cexa1 b.1.1.0 (A:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqpsqlsvapgetariscggrslgsravqwyqqkpgqapvlviynnqdrpsgiperfsgs
pdttatltisrveagdeadyychmwdsrsainwvfgggtkltvlg

Timeline for d5cexa1:

• d5cexa1 first appeared in SCOPe 2.06
  
• d5cexa1 appears in SCOPe 2.07