SCOPe 2.07: Domain d5c5sa1: 5c5s A:110-318

Lineage for d5c5sa1 (5c5s A:110-318)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)

8. Domain d5c5sa1: 5c5s A:110-318 [310327]
   Other proteins in same PDB: d5c5sa2
   automated match to d1rgpa_

Details for d5c5sa1

PDB Entry: 5c5s, 2.2 Å

PDB Description: crystal structure of human myosin 9b rhogap domain at 2.2 angstrom

PDB Compounds: (A:) Unconventional myosin-IXb

SCOPe Domain Sequences for d5c5sa1:

Sequence; same for both SEQRES and ATOM records:

>d5c5sa1 a.116.1.0 (A:110-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgvepghfgvcvdsltsdkasvpivlekllehvemhglyteglyrksgaanrtrelrqal
qtdpaavklenfpihaitgvlkqwlrelpeplmtfaqygdflravelpekqeqlaaiyav
lehlpeanhnslerlifhlvkvalledvnrmspgalaiifapcllrcpdnsdpltsmkdv
lkittcvemlikeqmrkykvkmeeisqle

Timeline for d5c5sa1:

• d5c5sa1 first appeared in SCOPe 2.06