![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries) |
![]() | Domain d5c5sa1: 5c5s A:110-318 [310327] Other proteins in same PDB: d5c5sa2 automated match to d1rgpa_ |
PDB Entry: 5c5s (more details), 2.2 Å
SCOPe Domain Sequences for d5c5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c5sa1 a.116.1.0 (A:110-318) automated matches {Human (Homo sapiens) [TaxId: 9606]} pgvepghfgvcvdsltsdkasvpivlekllehvemhglyteglyrksgaanrtrelrqal qtdpaavklenfpihaitgvlkqwlrelpeplmtfaqygdflravelpekqeqlaaiyav lehlpeanhnslerlifhlvkvalledvnrmspgalaiifapcllrcpdnsdpltsmkdv lkittcvemlikeqmrkykvkmeeisqle
Timeline for d5c5sa1: