Lineage for d5c5sa1 (5c5s A:110-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725299Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2725300Protein automated matches [226932] (4 species)
    not a true protein
  7. 2725303Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries)
  8. 2725316Domain d5c5sa1: 5c5s A:110-318 [310327]
    Other proteins in same PDB: d5c5sa2
    automated match to d1rgpa_

Details for d5c5sa1

PDB Entry: 5c5s (more details), 2.2 Å

PDB Description: crystal structure of human myosin 9b rhogap domain at 2.2 angstrom
PDB Compounds: (A:) Unconventional myosin-IXb

SCOPe Domain Sequences for d5c5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5sa1 a.116.1.0 (A:110-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgvepghfgvcvdsltsdkasvpivlekllehvemhglyteglyrksgaanrtrelrqal
qtdpaavklenfpihaitgvlkqwlrelpeplmtfaqygdflravelpekqeqlaaiyav
lehlpeanhnslerlifhlvkvalledvnrmspgalaiifapcllrcpdnsdpltsmkdv
lkittcvemlikeqmrkykvkmeeisqle

SCOPe Domain Coordinates for d5c5sa1:

Click to download the PDB-style file with coordinates for d5c5sa1.
(The format of our PDB-style files is described here.)

Timeline for d5c5sa1: