SCOPe 2.07: Domain d5bxhd1: 5bxh D:4-106

Lineage for d5bxhd1 (5bxh D:4-106)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d5bxhd1: 5bxh D:4-106 [310323]
   Other proteins in same PDB: d5bxha2, d5bxhb2, d5bxhc2, d5bxhd2
   automated match to d5bxbc_

Details for d5bxhd1

PDB Entry: 5bxh, 2.76 Å

PDB Description: crystal structure of pentameric kctd9 btb domain

PDB Compounds: (D:) BTB/POZ domain-containing protein KCTD9

SCOPe Domain Sequences for d5bxhd1:

Sequence, based on SEQRES records:

>d5bxhd1 d.42.1.0 (D:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyfepi
lnylrhgqlivndginllgvleearffgidsliehlevaikns

Sequence, based on observed residues (ATOM records):

>d5bxhd1 d.42.1.0 (D:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwltlnvggryftttrstlvnkepdsmlahmfkwgnkqdhrgaflidrspeyfepilnyl
rhgqlivndginllgvleearffgidsliehlevaikns

Timeline for d5bxhd1:

• d5bxhd1 first appeared in SCOPe 2.06
  
• d5bxhd1 appears in the current release, SCOPe 2.08