SCOPe 2.08: Domain d1g7sa3: 1g7s A:329-459

Lineage for d1g7sa3 (1g7s A:329-459)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.20: Initiation factor IF2/eIF5b, domain 3 [52155] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.20.1: Initiation factor IF2/eIF5b, domain 3 [52156] (1 family)
   automatically mapped to Pfam PF11987

5. Family c.20.1.1: Initiation factor IF2/eIF5b, domain 3 [52157] (1 protein)

6. Protein Initiation factor IF2/eIF5b, domain 3 [52158] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [52159] (3 PDB entries)

8. Domain d1g7sa3: 1g7s A:329-459 [31032]
   Other proteins in same PDB: d1g7sa1, d1g7sa2, d1g7sa4
   complexed with gdp

Details for d1g7sa3

PDB Entry: 1g7s, 2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b complexed with gdp

PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7sa3:

Sequence; same for both SEQRES and ATOM records:

>d1g7sa3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
dpekvreeilseiedikidtdeagvvvkadtlgsleavvkilrdmyvpikvadigdvsrr
dvvnagialqedrvygaiiafnvkvipsaaqelknsdiklfqgnviyrlmeeyeewvrgi
eeekkkkwmea

Timeline for d1g7sa3:

• d1g7sa3 first appeared (with stable ids) in SCOP 1.55
  
• d1g7sa3 appears in SCOPe 2.07