Lineage for d1mla_1 (1mla 3-127,198-307)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.19: Catalytic domain of malonyl-CoA ACP transacylase [52150] (1 superfamily) Superfamily c.19.1: Catalytic domain of malonyl-CoA ACP transacylase [52151] (1 family) 
Family c.19.1.1: Catalytic domain of malonyl-CoA ACP transacylase [52152] (1 protein) Protein Catalytic domain of malonyl-CoA ACP transacylase [52153] (1 species) Species Escherichia coli [TaxId:562] [52154] (1 PDB entry) 
Domain d1mla_1: 1mla 3-127,198-307 [31031]
Other proteins in same PDB: d1mla_2
Details for d1mla_1
PDB Entry: 1mla (more details), 1.5 Å
PDB Description: the escherichia coli malonyl-coa:acyl carrier protein transacylase at 1.5-angstroms resolution. crystal structure of a fatty acid synthase component
SCOP Domain Sequences for d1mla_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mla_1 c.19.1.1 (3-127,198-307) Catalytic domain of malonyl-CoA ACP transacylase {Escherichia coli}
qfafvfpgqgsqtvgmladmaasypiveetfaeasaalgydlwaltqqgpaeelnktwqt
qpalltasvalyrvwqqqggkapammaghslgeysalvcagvidfadavrlvemrgkfmq
eavpeXvpshcalmkpaadklavelakitfnaptvpvvnnvdvkcetngdairdalvrql
ynpvqwtksveymaaqgvehlyevgpgkvltgltkrivdtltasalnepsamaaal
SCOP Domain Coordinates for d1mla_1:
Click to download the PDB-style file with coordinates for d1mla_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mla_1:
- d1mla_1 appears in SCOP 1.57
- d1mla_1 appears in the current release, SCOPe 2.08, called d1mlaa1
View in 3D
