Lineage for d5bunb_ (5bun B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022539Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 3022540Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 3022541Family f.5.1.1: Outer membrane efflux proteins (OEP) [56955] (3 proteins)
    Pfam PF02321
  6. 3022557Protein automated matches [191223] (3 species)
    not a true protein
  7. 3022572Species Salmonella enterica [TaxId:90370] [311490] (1 PDB entry)
  8. 3022574Domain d5bunb_: 5bun B: [310309]
    automated match to d1ek9a_
    complexed with bog

Details for d5bunb_

PDB Entry: 5bun (more details), 2.98 Å

PDB Description: crystal structure of an antigenic outer membrane protein st50 from salmonella typhi
PDB Compounds: (B:) Outer membrane protein

SCOPe Domain Sequences for d5bunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bunb_ f.5.1.1 (B:) automated matches {Salmonella enterica [TaxId: 90370]}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnetsaslqltqtlfdmskwrgltlqekaagiqdvtyqtdqqtlilntanayfkvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlanevtarnnldnave
elrqvtgnyypelaslnvehfktdkpkavnallkeaenrnlsllqarlsqdlareqirqa
qdghlptlnltastgisdtsysgsktnstqyddsnmgqnkiglnfslplyqggmvnsqvk
qaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldameagys
vgtrtivdvldatttlydakqqlanarytylinqlnikyalgtlneqdllalnstlgkpi
ptspe

SCOPe Domain Coordinates for d5bunb_:

Click to download the PDB-style file with coordinates for d5bunb_.
(The format of our PDB-style files is described here.)

Timeline for d5bunb_: