Lineage for d5bofb1 (5bof B:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947721Species Staphylococcus aureus [TaxId:1280] [311488] (2 PDB entries)
  8. 2947725Domain d5bofb1: 5bof B:1-139 [310306]
    Other proteins in same PDB: d5bofa2, d5bofb2
    automated match to d1w6ta2
    complexed with mg, so4

Details for d5bofb1

PDB Entry: 5bof (more details), 2.45 Å

PDB Description: crystal structure of staphylococcus aureus enolase
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d5bofb1:

Sequence, based on SEQRES records: (download)

>d5bofb1 d.54.1.1 (B:1-139) Enolase {Staphylococcus aureus [TaxId: 1280]}
mpiitdvyarevldsrgnptvevevltesgafgralvpsgastgeheavelrdgdksryl
gkgvtkavenvneiiapeiiegefsvldqvsidkmmialdgtpnkgklganailgvsiav
araaadllgqplykylggf

Sequence, based on observed residues (ATOM records): (download)

>d5bofb1 d.54.1.1 (B:1-139) Enolase {Staphylococcus aureus [TaxId: 1280]}
mpiitdvyarevldsrgnptvevevltesgafgralvpsgaseheavelrdgdksrylgk
gvtkavenvneiiapeiiegefsvldqvsidkmmialdgtpnkgklganailgvsiavar
aaadllgqplykylggf

SCOPe Domain Coordinates for d5bofb1:

Click to download the PDB-style file with coordinates for d5bofb1.
(The format of our PDB-style files is described here.)

Timeline for d5bofb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bofb2