Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein Enolase [54828] (10 species) |
Species Staphylococcus aureus [TaxId:1280] [311488] (2 PDB entries) |
Domain d5boeb1: 5boe B:1-139 [310302] Other proteins in same PDB: d5boea2, d5boeb2 automated match to d1w6ta2 complexed with gol, mg, pep |
PDB Entry: 5boe (more details), 1.6 Å
SCOPe Domain Sequences for d5boeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5boeb1 d.54.1.1 (B:1-139) Enolase {Staphylococcus aureus [TaxId: 1280]} mpiitdvyarevldsrgnptvevevltesgafgralvpsgastgeheavelrdgdksryl gkgvtkavenvneiiapeiiegefsvldqvsidkmmialdgtpnkgklganailgvsiav araaadllgqplykylggf
Timeline for d5boeb1: