SCOPe 2.08: Domain d5boea1: 5boe A:1-139

Lineage for d5boea1 (5boe A:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Staphylococcus aureus [TaxId:1280] [311488] (2 PDB entries)

8. Domain d5boea1: 5boe A:1-139 [310300]
   Other proteins in same PDB: d5boea2, d5boeb2
   automated match to d1w6ta2
   complexed with gol, mg, pep

Details for d5boea1

PDB Entry: 5boe, 1.6 Å

PDB Description: crystal structure of staphylococcus aureus enolase in complex with pep

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5boea1:

Sequence; same for both SEQRES and ATOM records:

>d5boea1 d.54.1.1 (A:1-139) Enolase {Staphylococcus aureus [TaxId: 1280]}
mpiitdvyarevldsrgnptvevevltesgafgralvpsgastgeheavelrdgdksryl
gkgvtkavenvneiiapeiiegefsvldqvsidkmmialdgtpnkgklganailgvsiav
araaadllgqplykylggf

Timeline for d5boea1:

• d5boea1 first appeared in SCOPe 2.06
  
• d5boea1 appears in SCOPe 2.07