Lineage for d1muga_ (1mug A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114393Family c.18.1.2: Mug-like [52147] (3 proteins)
  6. 2114398Protein G:T/U mismatch-specific DNA glycosylase, Mug [52148] (1 species)
  7. 2114399Species Escherichia coli [TaxId:562] [52149] (4 PDB entries)
  8. 2114400Domain d1muga_: 1mug A: [31030]
    complexed with so4

Details for d1muga_

PDB Entry: 1mug (more details), 1.8 Å

PDB Description: g:t/u mismatch-specific dna glycosylase from e.coli
PDB Compounds: (A:) protein (g:t/u specific DNA glycosylase)

SCOPe Domain Sequences for d1muga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]}
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv

SCOPe Domain Coordinates for d1muga_:

Click to download the PDB-style file with coordinates for d1muga_.
(The format of our PDB-style files is described here.)

Timeline for d1muga_: