Lineage for d1muga_ (1mug A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21741Family c.18.1.2: G:T/U mismatch-specific DNA glycosylase [52147] (1 protein)
  6. 21742Protein G:T/U mismatch-specific DNA glycosylase [52148] (1 species)
  7. 21743Species Escherichia coli [TaxId:562] [52149] (1 PDB entry)
  8. 21744Domain d1muga_: 1mug A: [31030]

Details for d1muga_

PDB Entry: 1mug (more details), 1.8 Å

PDB Description: g:t/u mismatch-specific dna glycosylase from e.coli

SCOP Domain Sequences for d1muga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase {Escherichia coli}
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv

SCOP Domain Coordinates for d1muga_:

Click to download the PDB-style file with coordinates for d1muga_.
(The format of our PDB-style files is described here.)

Timeline for d1muga_: