Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) |
Superfamily c.18.1: DNA glycosylase [52141] (2 families) |
Family c.18.1.2: G:T/U mismatch-specific DNA glycosylase [52147] (1 protein) |
Protein G:T/U mismatch-specific DNA glycosylase [52148] (1 species) |
Species Escherichia coli [TaxId:562] [52149] (1 PDB entry) |
Domain d1muga_: 1mug A: [31030] |
PDB Entry: 1mug (more details), 1.8 Å
SCOP Domain Sequences for d1muga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase {Escherichia coli} mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv
Timeline for d1muga_: