Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) |
Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins) |
Protein Sodium/potassium-transporting ATPase, transmembrane domain [310694] (2 species) the N-terminal 57 residues interact with/form a part of the acuator domain A |
Species Dogfish (Squalus acanthias) [TaxId:7797] [310915] (15 PDB entries) |
Domain d5aw9a1: 5aw9 A:32-166,A:275-368,A:766-1023 [310291] Other proteins in same PDB: d5aw9a2, d5aw9a3, d5aw9a4, d5aw9b1, d5aw9b2, d5aw9g_ automated match to d2zxea4 complexed with clr, k, mf4, mg, nag |
PDB Entry: 5aw9 (more details), 2.8 Å
SCOPe Domain Sequences for d5aw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aw9a1 f.33.1.1 (A:32-166,A:275-368,A:766-1023) Sodium/potassium-transporting ATPase, transmembrane domain {Dogfish (Squalus acanthias) [TaxId: 7797]} ldelkkevsmddhklsldelhnkygtdltrgltnarakeilardgpnsltpppttpewik fcrqlfggfsillwigailcflaygiqaatedepandnlylgvvlstvvivtgcfsyyqe akssrimdsfknmvpXsglevgrtpiaieiehfihiitgvavflgvsffilslilgyswl eavifligiivanvpegllatvtvcltltakrmarknclvknleavetlgXrlifdnlkk siaytltsnipeitpflvfiignvplplgtvtilcidlgtdmvpaislayeqaesdimkr qprnpktdklvnerlismaygqigmiqalggffsyfvilaengflpmdligkrvrwddrw isdvedsfgqqwtyeqrkiveftchtsffisivvvqwadliicktrrnsifqqgmknkil ifglfeetalaaflsycpgtdvalrmyplkpswwfcafpysliiflydemrrfiirrspg gwveqetyy
Timeline for d5aw9a1: