Lineage for d5aw9a1 (5aw9 A:32-166,A:275-368,A:766-1023)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255902Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 2255903Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 2255904Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 2255960Protein Sodium/potassium-transporting ATPase, transmembrane domain [310694] (2 species)
    the N-terminal 57 residues interact with/form a part of the acuator domain A
  7. 2255961Species Dogfish (Squalus acanthias) [TaxId:7797] [310915] (15 PDB entries)
  8. 2255971Domain d5aw9a1: 5aw9 A:32-166,A:275-368,A:766-1023 [310291]
    Other proteins in same PDB: d5aw9a2, d5aw9a3, d5aw9a4, d5aw9b1, d5aw9b2, d5aw9g_
    automated match to d2zxea4
    complexed with clr, k, mf4, mg, nag

Details for d5aw9a1

PDB Entry: 5aw9 (more details), 2.8 Å

PDB Description: kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5aw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aw9a1 f.33.1.1 (A:32-166,A:275-368,A:766-1023) Sodium/potassium-transporting ATPase, transmembrane domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
ldelkkevsmddhklsldelhnkygtdltrgltnarakeilardgpnsltpppttpewik
fcrqlfggfsillwigailcflaygiqaatedepandnlylgvvlstvvivtgcfsyyqe
akssrimdsfknmvpXsglevgrtpiaieiehfihiitgvavflgvsffilslilgyswl
eavifligiivanvpegllatvtvcltltakrmarknclvknleavetlgXrlifdnlkk
siaytltsnipeitpflvfiignvplplgtvtilcidlgtdmvpaislayeqaesdimkr
qprnpktdklvnerlismaygqigmiqalggffsyfvilaengflpmdligkrvrwddrw
isdvedsfgqqwtyeqrkiveftchtsffisivvvqwadliicktrrnsifqqgmknkil
ifglfeetalaaflsycpgtdvalrmyplkpswwfcafpysliiflydemrrfiirrspg
gwveqetyy

SCOPe Domain Coordinates for d5aw9a1:

Click to download the PDB-style file with coordinates for d5aw9a1.
(The format of our PDB-style files is described here.)

Timeline for d5aw9a1: