| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: DNA glycosylase [52141] (3 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
| Protein Uracil-DNA glycosylase [52143] (4 species) |
| Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
| Domain d1euib_: 1eui B: [31029] Other proteins in same PDB: d1euic_, d1euid_ |
PDB Entry: 1eui (more details), 3.2 Å
SCOP Domain Sequences for d1euib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euib_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli}
twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
Timeline for d1euib_: