Lineage for d1euib_ (1eui B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480922Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 480923Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 480924Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 480925Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 480929Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 480947Domain d1euib_: 1eui B: [31029]
    Other proteins in same PDB: d1euic_, d1euid_

Details for d1euib_

PDB Entry: 1eui (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1euib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euib_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli}
twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp

SCOP Domain Coordinates for d1euib_:

Click to download the PDB-style file with coordinates for d1euib_.
(The format of our PDB-style files is described here.)

Timeline for d1euib_: