Lineage for d5aw8a2 (5aw8 A:167-274)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082621Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2082622Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2082678Protein Sodium/potassium-transporting ATPase, actuator domain A [310693] (2 species)
  7. 2082679Species Dogfish (Squalus acanthias) [TaxId:7797] [310913] (15 PDB entries)
  8. 2082686Domain d5aw8a2: 5aw8 A:167-274 [310285]
    Other proteins in same PDB: d5aw8a1, d5aw8a3, d5aw8a4, d5aw8b1, d5aw8b2, d5aw8g_
    automated match to d2zxea3
    complexed with clr, mf4, mg, nag, rb

Details for d5aw8a2

PDB Entry: 5aw8 (more details), 2.8 Å

PDB Description: kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5aw8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aw8a2 b.82.7.1 (A:167-274) Sodium/potassium-transporting ATPase, actuator domain A {Dogfish (Squalus acanthias) [TaxId: 7797]}
qqalvirdgekstinaefvvagdlvevkggdripadlriisahgckvdnssltgesepqt
rspefssenpletrniaffstncvegtargvvvytgdrtvmgriatla

SCOPe Domain Coordinates for d5aw8a2:

Click to download the PDB-style file with coordinates for d5aw8a2.
(The format of our PDB-style files is described here.)

Timeline for d5aw8a2: