Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
Protein Sodium/potassium-transporting ATPase, actuator domain A [310693] (2 species) |
Species Dogfish (Squalus acanthias) [TaxId:7797] [310913] (15 PDB entries) |
Domain d5aw8a2: 5aw8 A:167-274 [310285] Other proteins in same PDB: d5aw8a1, d5aw8a3, d5aw8a4, d5aw8b1, d5aw8b2, d5aw8g_ automated match to d2zxea3 complexed with clr, mf4, mg, nag, rb |
PDB Entry: 5aw8 (more details), 2.8 Å
SCOPe Domain Sequences for d5aw8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aw8a2 b.82.7.1 (A:167-274) Sodium/potassium-transporting ATPase, actuator domain A {Dogfish (Squalus acanthias) [TaxId: 7797]} qqalvirdgekstinaefvvagdlvevkggdripadlriisahgckvdnssltgesepqt rspefssenpletrniaffstncvegtargvvvytgdrtvmgriatla
Timeline for d5aw8a2: