Lineage for d1euia_ (1eui A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691382Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691383Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families) (S)
  5. 691384Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 691385Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 691389Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 691406Domain d1euia_: 1eui A: [31028]
    Other proteins in same PDB: d1euic_, d1euid_

Details for d1euia_

PDB Entry: 1eui (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d1euia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euia_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

SCOP Domain Coordinates for d1euia_:

Click to download the PDB-style file with coordinates for d1euia_.
(The format of our PDB-style files is described here.)

Timeline for d1euia_: