Lineage for d2uugb_ (2uug B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578428Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 578429Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 578430Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 578431Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 578435Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 578444Domain d2uugb_: 2uug B: [31026]
    Other proteins in same PDB: d2uugc_, d2uugd_
    mutant

Details for d2uugb_

PDB Entry: 2uug (more details), 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi

SCOP Domain Sequences for d2uugb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uugb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

SCOP Domain Coordinates for d2uugb_:

Click to download the PDB-style file with coordinates for d2uugb_.
(The format of our PDB-style files is described here.)

Timeline for d2uugb_: