SCOP 1.65: Domain d2uugb_: 2uug B:

Lineage for d2uugb_ (2uug B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d2uugb_: 2uug B: [31026]
   Other proteins in same PDB: d2uugc_, d2uugd_
   mutant

Details for d2uugb_

PDB Entry: 2uug, 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi

SCOP Domain Sequences for d2uugb_:

Sequence; same for both SEQRES and ATOM records:

>d2uugb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

Timeline for d2uugb_:

• d2uugb_ first appeared (with stable ids) in SCOP 1.55
  
• d2uugb_ appears in SCOP 1.63
  
• d2uugb_ appears in SCOP 1.67
  
• d2uugb_ appears in the current release, SCOPe 2.08