Lineage for d5aw4a2 (5aw4 A:167-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817328Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2817329Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2817384Protein Sodium/potassium-transporting ATPase, actuator domain A [310693] (2 species)
  7. 2817385Species Dogfish (Squalus acanthias) [TaxId:7797] [310913] (15 PDB entries)
  8. 2817393Domain d5aw4a2: 5aw4 A:167-274 [310257]
    Other proteins in same PDB: d5aw4a1, d5aw4a3, d5aw4a4, d5aw4b1, d5aw4b2, d5aw4g_
    automated match to d2zxea3
    complexed with clr, k, mf4, mg, nag, rb

Details for d5aw4a2

PDB Entry: 5aw4 (more details), 2.8 Å

PDB Description: kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5aw4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aw4a2 b.82.7.1 (A:167-274) Sodium/potassium-transporting ATPase, actuator domain A {Dogfish (Squalus acanthias) [TaxId: 7797]}
qqalvirdgekstinaefvvagdlvevkggdripadlriisahgckvdnssltgesepqt
rspefssenpletrniaffstncvegtargvvvytgdrtvmgriatla

SCOPe Domain Coordinates for d5aw4a2:

Click to download the PDB-style file with coordinates for d5aw4a2.
(The format of our PDB-style files is described here.)

Timeline for d5aw4a2: