Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) Pfam PF02038 |
Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins) |
Protein Phospholemman-like protein, FXYD10 [310697] (1 species) |
Species Dogfish (Squalus acanthias) [TaxId:7797] [310919] (15 PDB entries) |
Domain d5avwg_: 5avw G: [310255] Other proteins in same PDB: d5avwa1, d5avwa2, d5avwa3, d5avwa4, d5avwb1, d5avwb2 automated match to d2zxeg_ complexed with clr, k, mf4, mg, nag, tl |
PDB Entry: 5avw (more details), 2.6 Å
SCOPe Domain Sequences for d5avwg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5avwg_ f.23.43.1 (G:) Phospholemman-like protein, FXYD10 {Dogfish (Squalus acanthias) [TaxId: 7797]} egpdnderftydyyrlrvvglivaavlcvigiiillagk
Timeline for d5avwg_: