Lineage for d5avwa3 (5avw A:369-385,A:594-765)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919808Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2919868Protein Sodium/potassium-transporting ATPase alpha chain [310692] (2 species)
  7. 2919869Species Dogfish (Squalus acanthias) [TaxId:7797] [310911] (15 PDB entries)
  8. 2919872Domain d5avwa3: 5avw A:369-385,A:594-765 [310251]
    Other proteins in same PDB: d5avwa1, d5avwa2, d5avwa4, d5avwb1, d5avwb2, d5avwg_
    automated match to d2zxea2
    complexed with clr, k, mf4, mg, nag, tl

Details for d5avwa3

PDB Entry: 5avw (more details), 2.6 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5avwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avwa3 c.108.1.7 (A:369-385,A:594-765) Sodium/potassium-transporting ATPase alpha chain {Dogfish (Squalus acanthias) [TaxId: 7797]}
ststicsdktgtltqnrXppraavpdavgkcrsagikvimvtgdhpitakaiakgvgiis
egnetiediaarlnipigqvnprdakacvvhgsdlkdlstevlddilhyhteivfartsp
qqkliivegcqrqgaivavtgdgvndspalkkadigvamgisgsdvskqaadmillddnf
asivtgveeg

SCOPe Domain Coordinates for d5avwa3:

Click to download the PDB-style file with coordinates for d5avwa3.
(The format of our PDB-style files is described here.)

Timeline for d5avwa3: