Lineage for d2uuga_ (2uug A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310926Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 310927Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 310928Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 310929Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 310930Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 310938Domain d2uuga_: 2uug A: [31025]
    Other proteins in same PDB: d2uugc_, d2uugd_

Details for d2uuga_

PDB Entry: 2uug (more details), 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi

SCOP Domain Sequences for d2uuga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae

SCOP Domain Coordinates for d2uuga_:

Click to download the PDB-style file with coordinates for d2uuga_.
(The format of our PDB-style files is described here.)

Timeline for d2uuga_: