![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
![]() | Protein Uracil-DNA glycosylase [52143] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
![]() | Domain d2uuga_: 2uug A: [31025] Other proteins in same PDB: d2uugc_, d2uugd_ protein/DNA complex; mutant |
PDB Entry: 2uug (more details), 2.6 Å
SCOPe Domain Sequences for d2uuga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae
Timeline for d2uuga_: