Lineage for d5avvg_ (5avv G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255060Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) (S)
    Pfam PF02038
  5. 2255061Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins)
  6. 2255062Protein Phospholemman-like protein, FXYD10 [310697] (1 species)
  7. 2255063Species Dogfish (Squalus acanthias) [TaxId:7797] [310919] (15 PDB entries)
  8. 2255075Domain d5avvg_: 5avv G: [310248]
    Other proteins in same PDB: d5avva1, d5avva2, d5avva3, d5avva4, d5avvb1, d5avvb2
    automated match to d2zxeg_
    complexed with clr, k, mf4, mg, nag, tl

Details for d5avvg_

PDB Entry: 5avv (more details), 2.9 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
PDB Compounds: (G:) Phospholemman-like protein

SCOPe Domain Sequences for d5avvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avvg_ f.23.43.1 (G:) Phospholemman-like protein, FXYD10 {Dogfish (Squalus acanthias) [TaxId: 7797]}
egpdnderftydyyrlrvvglivaavlcvigiiillagk

SCOPe Domain Coordinates for d5avvg_:

Click to download the PDB-style file with coordinates for d5avvg_.
(The format of our PDB-style files is described here.)

Timeline for d5avvg_: