SCOP 1.75: Domain d1uugc_: 1uug C:

Lineage for d1uugc_ (1uug C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1uugc_: 1uug C: [31024]
   Other proteins in same PDB: d1uugb_, d1uugd_

Details for d1uugc_

PDB Entry: 1uug, 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi

PDB Compounds: (C:) uracil-DNA glycosylase

SCOP Domain Sequences for d1uugc_:

Sequence; same for both SEQRES and ATOM records:

>d1uugc_ c.18.1.1 (C:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp

Timeline for d1uugc_:

• d1uugc_ first appeared (with stable ids) in SCOP 1.55
  
• d1uugc_ appears in SCOP 1.73
  
• d1uugc_ appears in SCOPe 2.01
  
• d1uugc_ appears in the current release, SCOPe 2.08