Lineage for d1uugc_ (1uug C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68069Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 68070Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 68071Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 68072Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 68073Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)
  8. 68080Domain d1uugc_: 1uug C: [31024]
    Other proteins in same PDB: d1uugb_, d1uugd_

Details for d1uugc_

PDB Entry: 1uug (more details), 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi

SCOP Domain Sequences for d1uugc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uugc_ c.18.1.1 (C:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp

SCOP Domain Coordinates for d1uugc_:

Click to download the PDB-style file with coordinates for d1uugc_.
(The format of our PDB-style files is described here.)

Timeline for d1uugc_: