Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) |
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
Protein Sodium/potassium-transporting ATPase alpha chain [90068] (3 species) |
Species Dogfish (Squalus acanthias) [TaxId:7797] [310909] (15 PDB entries) |
Domain d5avua4: 5avu A:386-593 [310238] Other proteins in same PDB: d5avua1, d5avua2, d5avua3, d5avub1, d5avub2, d5avug_ automated match to d2zxea1 complexed with clr, k, mf4, mg, nag, tl has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5avu (more details), 2.55 Å
SCOPe Domain Sequences for d5avua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5avua4 d.220.1.1 (A:386-593) Sodium/potassium-transporting ATPase alpha chain {Dogfish (Squalus acanthias) [TaxId: 7797]} mtvahmwfdnqiheadttenqsgaafdktsatwsalsriaalcnravfqagqdnvpilkr svagdasesallkcielccgsvqgmrdrnpkiveipfnstnkyqlsihenekssesryll vmkgaperildrcstillngaeeplkedmkeafqnaylelgglgervlgfchfalpedky negypfdadepnfpttdlcfvglmamid
Timeline for d5avua4: