Lineage for d1uuga_ (1uug A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21713Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 21714Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 21715Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)
  8. 21721Domain d1uuga_: 1uug A: [31023]
    Other proteins in same PDB: d1uugb_, d1uugd_

Details for d1uuga_

PDB Entry: 1uug (more details), 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi

SCOP Domain Sequences for d1uuga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

SCOP Domain Coordinates for d1uuga_:

Click to download the PDB-style file with coordinates for d1uuga_.
(The format of our PDB-style files is described here.)

Timeline for d1uuga_: