Lineage for d5avsb2 (5avs B:69-305)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040253Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (1 family) (S)
    May be homologous to IL1R (49177), according to PubMed 18075585
  5. 2040254Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 proteins)
  6. 2040255Protein Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310696] (1 species)
  7. 2040256Species Dogfish (Squalus acanthias) [TaxId:7797] [310918] (14 PDB entries)
  8. 2040270Domain d5avsb2: 5avs B:69-305 [310226]
    Other proteins in same PDB: d5avsa1, d5avsa2, d5avsa3, d5avsa4, d5avsb1, d5avsg_
    automated match to d2zxeb2
    complexed with clr, k, mf4, mg, nag, tl

Details for d5avsb2

PDB Entry: 5avs (more details), 2.9 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 3.5 min
PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d5avsb2:

Sequence, based on SEQRES records: (download)

>d5avsb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy
pkplknttdlpeelqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy
gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Sequence, based on observed residues (ATOM records): (download)

>d5avsb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt
dlpeelqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll
aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

SCOPe Domain Coordinates for d5avsb2:

Click to download the PDB-style file with coordinates for d5avsb2.
(The format of our PDB-style files is described here.)

Timeline for d5avsb2: