Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) |
Superfamily c.18.1: DNA glycosylase [52141] (2 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
Protein Uracil-DNA glycosylase [52143] (3 species) |
Species Escherichia coli [TaxId:562] [52146] (9 PDB entries) |
Domain d5euga_: 5eug A: [31022] |
PDB Entry: 5eug (more details), 1.6 Å
SCOP Domain Sequences for d5euga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli} ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk apqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
Timeline for d5euga_: