Lineage for d5euga_ (5eug A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21713Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 21714Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 21715Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)
  8. 21720Domain d5euga_: 5eug A: [31022]

Details for d5euga_

PDB Entry: 5eug (more details), 1.6 Å

PDB Description: crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex
PDB Compounds: (A:)

SCOP Domain Sequences for d5euga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOP Domain Coordinates for d5euga_:

Click to download the PDB-style file with coordinates for d5euga_.
(The format of our PDB-style files is described here.)

Timeline for d5euga_: