![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (2 families) ![]() May be homologous to IL1R (49177), according to PubMed 18075585 |
![]() | Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 proteins) |
![]() | Protein Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310696] (1 species) |
![]() | Species Dogfish (Squalus acanthias) [TaxId:7797] [310918] (14 PDB entries) |
![]() | Domain d5avqb2: 5avq B:69-305 [310212] Other proteins in same PDB: d5avqa1, d5avqa2, d5avqa3, d5avqa4, d5avqb1, d5avqg_ automated match to d2zxeb2 complexed with clr, k, mf4, mg, nag, tl |
PDB Entry: 5avq (more details), 2.6 Å
SCOPe Domain Sequences for d5avqb2:
Sequence, based on SEQRES records: (download)
>d5avqb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]} yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy pkplknttdlpeelqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks
>d5avqb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]} yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt dlpeelqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks
Timeline for d5avqb2: