Lineage for d1euga_ (1eug A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114319Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2114320Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2114335Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 2114339Domain d1euga_: 1eug A: [31021]
    CASP3
    protein/DNA complex

Details for d1euga_

PDB Entry: 1eug (more details), 1.6 Å

PDB Description: crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited
PDB Compounds: (A:) protein (glycosylase)

SCOPe Domain Sequences for d1euga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOPe Domain Coordinates for d1euga_:

Click to download the PDB-style file with coordinates for d1euga_.
(The format of our PDB-style files is described here.)

Timeline for d1euga_: