SCOPe 2.08: Domain d5avmg1: 5avm G:167-333

Lineage for d5avmg1 (5avm G:167-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [311487] (1 PDB entry)

8. Domain d5avmg1: 5avm G:167-333 [310205]
   Other proteins in same PDB: d5avma2, d5avmb2, d5avmc2, d5avmd2, d5avme2, d5avmf2, d5avmg2, d5avmh2
   automated match to d3m84a2
   complexed with so4

Details for d5avmg1

PDB Entry: 5avm, 2.2 Å

PDB Description: crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus

PDB Compounds: (G:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5avmg1:

Sequence; same for both SEQRES and ATOM records:

>d5avmg1 d.139.1.0 (G:167-333) automated matches {Thermus thermophilus [TaxId: 300852]}
gpervregdallalpssgphtngyslirkvvagqdlsapvpelgeslkeallrphraylk
efrllweagvelhaaahitggglpenlpralppglgaevrrgswpippvfpylqrlggip
eeemyrvfnmglgmvlvlpqeaaeealklvegflvgrvvpgegvrlv

Timeline for d5avmg1:

• d5avmg1 first appeared in SCOPe 2.06
  
• d5avmg1 appears in SCOPe 2.07