SCOP 1.75: Domain d2euga_: 2eug A:

Lineage for d2euga_ (2eug A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d2euga_: 2eug A: [31020]
   complexed with ura; mutant

Details for d2euga_

PDB Entry: 2eug, 1.5 Å

PDB Description: crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited

PDB Compounds: (A:) protein (glycosylase)

SCOP Domain Sequences for d2euga_:

Sequence; same for both SEQRES and ATOM records:

>d2euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

Timeline for d2euga_:

• d2euga_ first appeared (with stable ids) in SCOP 1.55
  
• d2euga_ appears in SCOP 1.73
  
• d2euga_ appears in SCOPe 2.01
  
• d2euga_ appears in the current release, SCOPe 2.08