![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.18: DNA glycosylase [52140] (1 superfamily) |
![]() | Superfamily c.18.1: DNA glycosylase [52141] (2 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
![]() | Protein Uracil-DNA glycosylase [52143] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52146] (9 PDB entries) |
![]() | Domain d2euga_: 2eug A: [31020] |
PDB Entry: 2eug (more details), 1.5 Å
SCOP Domain Sequences for d2euga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli} ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
Timeline for d2euga_: