Lineage for d5apkb_ (5apk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343096Domain d5apkb_: 5apk B: [310194]
    Other proteins in same PDB: d5apka2
    automated match to d1n83a_
    complexed with 76e

Details for d5apkb_

PDB Entry: 5apk (more details), 2.1 Å

PDB Description: ligand complex of rorg lbd
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5apkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apkb_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp

SCOPe Domain Coordinates for d5apkb_:

Click to download the PDB-style file with coordinates for d5apkb_.
(The format of our PDB-style files is described here.)

Timeline for d5apkb_: