SCOPe 2.08: Domain d5apkb_: 5apk B:

Lineage for d5apkb_ (5apk B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d5apkb_: 5apk B: [310194]
   Other proteins in same PDB: d5apka2
   automated match to d1n83a_
   complexed with 76e

Details for d5apkb_

PDB Entry: 5apk, 2.1 Å

PDB Description: ligand complex of rorg lbd

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5apkb_:

Sequence; same for both SEQRES and ATOM records:

>d5apkb_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp

Timeline for d5apkb_:

• d5apkb_ first appeared in SCOPe 2.06
  
• d5apkb_ appears in SCOPe 2.07