Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries) |
Domain d5apka1: 5apk A:265-486 [310192] Other proteins in same PDB: d5apka2 automated match to d1n83a_ complexed with 76e |
PDB Entry: 5apk (more details), 2.1 Å
SCOPe Domain Sequences for d5apka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5apka1 a.123.1.0 (A:265-486) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqif
Timeline for d5apka1: