Lineage for d5apka1 (5apk A:265-486)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730057Domain d5apka1: 5apk A:265-486 [310192]
    Other proteins in same PDB: d5apka2
    automated match to d1n83a_
    complexed with 76e

Details for d5apka1

PDB Entry: 5apk (more details), 2.1 Å

PDB Description: ligand complex of rorg lbd
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5apka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apka1 a.123.1.0 (A:265-486) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqif

SCOPe Domain Coordinates for d5apka1:

Click to download the PDB-style file with coordinates for d5apka1.
(The format of our PDB-style files is described here.)

Timeline for d5apka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5apka2
View in 3D
Domains from other chains:
(mouse over for more information)
d5apkb_